LL-37 Acetate – Aliquot, 6mg

LL-37 Acetate – Aliquot, 6mg

$99.99

  • Batch and lot coded with publicly visible lab reports to ensure quality and transparency.
  • Less than 10% variance in concentration per lot, guaranteeing consistency.
  • Formulated with Acetate (counterion) instead of corrosive TFA for safety.
  • Crimp-top glass aliquot to minimize degradation.
  • Tamper-proof seal to ensure safety in transit.

Out of stock

Lab Reports
SKU: ll-37-6mg-aliquot Categories: , , , , Tags: , ,
Return or exchange your unopened product within 30 days no questions asked. If you are unsatisfied with your product we will issue a full refund. If you need to make a return the process is simple, straightforward and tracked. Our checkout is SSL encrypted and completely secure. Order today and we will ship the very same day, every business day. Our products are verified by independent third party laboratories to meet quality standards. All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.

Data Sheet

LL-37 Acetate – Aliquot, 6mg

Application Agonist of formyl peptide receptor like-1 (FPRL-1), purinergic receptor P2X7, epidermal growth factor receptor (EGFR) and insulin-like growth factor-1 receptor (IGF-1R)
CAS 154947-66-7
Molar Mass 4493 g/mol
Chemical Formula C205H340N60O53
Amino Acid Sequence [LL-37, 37 aa]
Synonyms CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536
Storage Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture
Solubility Soluble in BAC water
Organoleptic Profile Solid, white powder in 3mL glass aliquot
Composition Each aliquot contains LL-37, Acetate (counterion)
Specification LL-37 content for each variant (per aliquot):
LL-37 6mg ±10%
Terms This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.